PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013600011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 278aa    MW: 30898.6 Da    PI: 6.5343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013600011.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.5e-19651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l   v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_013600011.1  6 KGPWSQEEDEQLRLMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding53.36.5e-1760102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +v a +++G++ W+tIar ++ gRt++ +k++w++ 
   XP_013600011.1  60 PFSPEEDETIVSARAKFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.707156IPR017930Myb domain
SuperFamilySSF466892.59E-31399IPR009057Homeodomain-like
SMARTSM007172.4E-17554IPR001005SANT/Myb domain
PfamPF002491.6E-18651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-25759IPR009057Homeodomain-like
CDDcd001678.54E-17850No hitNo description
SMARTSM007173.4E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.69858107IPR017930Myb domain
CDDcd001672.34E-1160103No hitNo description
PfamPF002494.0E-1460102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2260106IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MADRVKGPWS QEEDEQLRLM VEKYGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP  60
FSPEEDETIV SARAKFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCLDG NPTTEEDQDR  120
AKKRRSMSSE SVPPVDTGLY MSPESPTHVA SDSSAVPPQL FKPMPVSGGF TVPSPVEMTS  180
SLEDDPATTL SLSLSLPVSQ ESRNTGSSDN SLPFPKFESQ MKINVDERGE ARRAEFMTVV  240
HEMVKAEVRS YMAEMQRNNG GGFVVGGFYD SGITPKVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-3951073105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-3951073105C-Myb DNA-Binding Domain
1msf_C4e-3951073105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103124KRKCLDGNPTTEEDQDRAKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667430.0KC966743.1 Brassica napus MYB transcription factor 77 (MYB77.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600011.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-96MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3DRT50.0A0A0D3DRT5_BRAOL; Uncharacterized protein
STRINGBra036048.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135981527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-125myb domain protein 77